PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Zmw_sc00758.1.g00280.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Chloridoideae; Zoysieae; Zoysiinae; Zoysia
Family MYB
Protein Properties Length: 237aa    MW: 26677.5 Da    PI: 10.5279
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Zmw_sc00758.1.g00280.1genomeZGD-
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding46.68.1e-15453148
                                  TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHT..TTS-HHHHHHHHHHHT CS
               Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmg..kgRtlkqcksrwqkyl 48
                                  r+rW +eEd  l  +v+q+G++ W++++++m+  + R +k+c +rw +yl
  Zmw_sc00758.1.g00280.1.am.mk  4 RQRWRPEEDAVLRAYVRQYGPREWHLVSQRMNvaLDRDAKSCHERWKNYL 53
                                  89**********************************************97 PP

2Myb_DNA-binding37.36.4e-1259103147
                                   TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
               Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47 
                                   +g+ T+eE+ l +++ +++G++ Wk+Ia++++ gRt+k +  +w  +
  Zmw_sc00758.1.g00280.1.am.mk  59 KGSLTEEEQRLVIRLQAKHGNK-WKKIAAEVP-GRTAKRLGKWWEVF 103
                                   6788******************.*********.*****999999766 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129415.123153IPR017930Myb domain
SMARTSM007179.9E-12355IPR001005SANT/Myb domain
SuperFamilySSF466891.42E-21498IPR009057Homeodomain-like
CDDcd001671.90E-9653No hitNo description
Gene3DG3DSA:1.10.10.601.4E-20660IPR009057Homeodomain-like
PfamPF139211.1E-13767No hitNo description
PROSITE profilePS5129423.37554108IPR017930Myb domain
SMARTSM007172.8E-1058106IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.601.1E-1561102IPR009057Homeodomain-like
CDDcd001671.08E-863104No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 237 aa     Download sequence    Send to blast
MKERQRWRPE EDAVLRAYVR QYGPREWHLV SQRMNVALDR DAKSCHERWK NYLRPGIKKG  60
SLTEEEQRLV IRLQAKHGNK WKKIAAEVPG RTAKRLGKWW EVFKEKQQRE LRGSRRPPPE  120
PSPDERGRYE WLLENFAEKL VNERLQPTPL LMAAPVLPPW LSSSATGHTV VTQPPSPSVT  180
LSLASATTPP ATVPPWMPAE RGAAADAFGF TTPQPPPAGA PTPQPGVAVV EGQALAE
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1gv2_A7e-167100797MYB PROTO-ONCOGENE PROTEIN
1mse_C7e-167100797C-Myb DNA-Binding Domain
1msf_C7e-167100797C-Myb DNA-Binding Domain
Search in ModeBase
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010922325.11e-102PREDICTED: transcription factor AS1-like
RefseqXP_010922324.11e-102PREDICTED: transcription factor AS1-like
RefseqXP_010922323.11e-102PREDICTED: transcription factor AS1-like
RefseqXP_010922322.11e-102PREDICTED: transcription factor AS1-like
SwissprotQ9S7B21e-101RS2_MAIZE; Protein rough sheath 2
TrEMBLW5FPB01e-102W5FPB0_WHEAT; Uncharacterized protein
STRINGGRMZM2G403620_P013e-99(Zea mays)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP51903654